|
|
||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
1 Department of Biological Sciences, Tokyo Institute of Technology, Yokohama 226-8501; 2 Ocean Research Institute, University of Tokyo, Tokyo 164-8639; 3 Department of Molecular Physiology, National Cardiovascular Center Research Institute, Osaka 565-8565, Japan; and 4 Department of Physiology and Biophysics, Case Western Reserve University, Cleveland, Ohio 44106
| |
ABSTRACT |
|---|
|
|
|---|
Despite unfavorable conditions, a
single species of fish, Osorezan dace, lives in an extremely acidic
lake (pH 3.5) in Osorezan, Aomori, Japan. Physiological studies have
established that this fish is able to prevent acidification of its
plasma and loss of Na+. Here we show that these abilities
are mainly attributable to the chloride cells of the gill, which are
arranged in a follicular structure and contain high concentrations of
Na+-K+-ATPase, carbonic anhydrase II, type 3 Na+/H+ exchanger (NHE3), type 1 Na+-HCO


aquaporin; carbonic anhydrase; glutamine catabolism; sodium-bicarbonate cotransporter; sodium/proton exchanger
| |
INTRODUCTION |
|---|
|
|
|---|
FISH CAN NORMALLY SURVIVE only in neutral or close-to-neutral water. A few exceptions are the Lake Magadi tilapia Oreochromis alcalicus grahami, the only fish in the alkaline lake (pH 10) (51), the Amazonian tambaqui Colossoma macropomum, which migrates between circumneutral water and dilute acidic blackwater of the Rio Negro (70, 71), and the Osorezan dace (35). The Osorezan dace Tribolodon hakonensis, a cyprinid teleost, lives and grows in the extremely acidic (pH 3.4-3.8) Lake Osorezan and migrates to neutral streams for spawning. Lake Osorezan (formally Lake Usoriyama) is located in the Shimokita Peninsula in the northern part of Honshu, the mainland of Japan. The mechanism of adaptation of the Lake Magadi tilapia to the alkaline condition is well understood (33, 51), but the mechanism of acid adaptation of the Amazonian tambaqui and Osorezan dace has not been clarified at the molecular level.
The gill epithelium comprises five types of cells (pavement cells,
mucous cells, neuroepithelial cells, undifferentiated cells, and
chloride cells) and is the site of respiratory gas exchange and ion
regulation (18, 26, 34, 44, 68). The gill is also believed
to possess a mechanism for preventing metabolic acidosis and alkalosis
(7, 8, 18). Long-term exposure of teleost fish to acidic
water affects the number, distribution, and morphology of chloride
cells in the gill (29, 30, 65) and can result in acute
acidification of plasma and loss of NaCl, eventually leading to death.
However, in Osorezan dace, these initial effects on plasma pH and
Na+ concentration are rapidly corrected, allowing the fish
to survive (25). To clarify the molecular mechanism
underlying the acid tolerance, we considered it useful to identify
proteins with expressions that are markedly increased in acid-adapted
Osorezan dace and performed subtraction cloning. Among several clones
isolated from a cDNA library enriched in acid-inducible messages, there
was a clone encoding the Na+- and K+-dependent
ATPase (Na+-K+-ATPase), the Na+
pump that generates the driving force for other ion-transporting systems, and surprisingly its message level was markedly increased in
the gill, but not in the kidney, of acid-adapted Osorezan dace. These
observations, together with the life history and acid tolerance of the
animal, suggested that chloride cells in the gill of Osorezan dace play
an important role in maintaining acid-base balance in a pH 3.5 environment by excreting H+ and transporting
HCO
H+ + HCO


This regulatory system is somewhat reminiscent of that working in the mammalian renal proximal tubule cells to defend against metabolic acidosis by reabsorbing bicarbonate and returning it to the buffer pool of the body (20, 61). Other important mechanisms operating in the proximal tubules are ammoniagenesis and gluconeogenesis, which generate two ammonia and two bicarbonate from the metabolism of glutamine and facilitate the excretion of acids and partially restore normal acid-base balance (6, 10). We therefore further examined the contribution of glutamine catabolism to systemic pH homeostasis and found that expression of glutamate dehydrogenase (GDH), a mitochondrial matrix enzyme that catalyzes oxidative deamination of glutamate and enhances ammonia production, is also markedly elevated in virtually all tissues when Osorezan dace is faced with acid challenges, suggesting a significant role in the acid adaptation. On the basis of these observations, we proposed a mechanism in which 1) the compensatory system in the chloride cells plays a major role in overcoming the Na+ loss and acidification and 2) glutamine catabolism in the whole body accomplishes a fine adjustment of systemic pH of Osorezan dace in a pH 3.5 lake.
| |
MATERIALS AND METHODS |
|---|
|
|
|---|
Materials.
The Osorezan dace were caught by netting in a neutral stream during the
spawning period (June) and acclimated in a 1-ton freshwater tank for
>1 mo before use. The water chemistry was as follows: pH 3.5-3.7,
0.92 mM Na+, 0.84 mM Cl
, 0.06 mM
K+, 0.21 mM Ca2+, 0.07 mM Mg2+, and
0.49 mM SO
, 0.02 mM K+,
0.11 mM Ca2+, 0.05 mM Mg2+, and 0.03 mM
SO
Transfer experiment. To examine the time-course changes in the mRNA levels of vacuolar-type H+-translocating ATPase (V-ATPase) B subunit, Na+-K+-ATPase, CA-II, NHE3, NBC1, aquaporin-3 (AQP3), and GDH after transfer to acidic water, neutral water-adapted dace (n = 40) were transferred directly to acidic lake water, and the gills were sampled from 10 dace on days 0, 1, 2, 5, and 7 for Northern blot analysis.
Molecular cloning.
Fragments of B subunit of V-ATPase, CA-II, NHE3, NBC1, and GDH cDNAs
were isolated from Osorezan dace by RT-PCR with gill mRNA. The
degenerate primers were as follows: 5'-ATIGCIGCICARATHTG-3' (sense) and
5'-ATITCITCRTTNGGCAT-3' (antisense) for B subunit of V-ATPase,
5'-CARTTYCAYTTYCAYTGGGG-3' (sense) and 5'-SRTAYTTNGTRTTCCARTG-3' (antisense) for CA-II, 5'-GCNGTKCTGGCNGTITTYGARGA-3' (sense) and 5'-GCNCCNCKNARICCICCRTA-3' (antisense) for NHE3,
5'-GARAARGTNGTRAARGGNGG-3' (sense) and 5'-TGRAANACYTCRTCISWCAT-3'
(antisense) for NBC1, and 5'-ATGACNTAYAARTGYGCNGT-3' (sense) and
5'-GCRTANGTRTCNGCDATCCA-3' (antisense) for GDH, where R is A or G,
Y is C or T, S is C or G, N is C, G, A, or T, K is G or T, W is A or T,
D is A, G, or T, H is A, C, or T, and I is inosine. Fragments of cDNAs
for the
-subunit of Na+-K+-ATPase and for
AQP3 were isolated with a subtraction cloning kit (Clontech);
corresponding full-length clones were obtained by screening a dace gill
cDNA library constructed in
ZAP II (Clontech). Filters were
prehybridized in a solution containing 50% formamide, 5×
saline-sodium citrate (SSC; 1× SSC is 0.15 M NaCl, 0.015 M sodium
citrate, pH 7.0), 5× Denhardt's solution (1× Denhardt's is 0.2%
Ficoll, 0.2% polyvinylpyrrolidone, and 0.2% bovine serum albumin),
and 0.1% SDS for 1 h at 42°C and then hybridized overnight at
42°C in the same solution containing
[
-32P]dCTP-labeled cDNA probe. Filters were washed in
1× SSC and 0.1% SDS at 60°C for 5 h. Positive inserts were
subcloned into pBluescript II (Stratagene) by the in vivo excision and
recircularization process in accordance with the
manufacturer's protocol and sequenced.
Northern blot analysis.
At various times after acid (pH 3.5) adaptation of Osorezan dace, we
isolated total RNA from the pools of various tissues of 10 fish and
subjected it to Northern blot analysis with a Hybond-N+
membrane (Amersham Biosciences) and [
-32P]dCTP-labeled
cDNA probes. Hybridization was performed in PerfectHyb solution
(Toyobo) at 68°C for 20 h. The membrane was then washed and
exposed to an imaging plate, which was processed with a Fujix BAS 2000 bioimaging analyzer. The probes comprised nucleotides 1-480 of
V-ATPase B subunit cDNA, nucleotides 315-415 of CA-II cDNA,
nucleotides 258-1147 of NHE3 cDNA, nucleotides 767-1403 of
NBC1 cDNA, nucleotides 71-679 of AQP3 cDNA, nucleotides 1-173 of GDH cDNA, and nucleotides 1-370 of the
Na+-K+-ATPase
-subunit cDNA. RNA molecular
weight marker II (1.5-6.9 kb; Roche) was used as the size marker.
Cell culture and cDNA transfection.
PS120 cells (47) were cultured in Dulbecco's modified
Eagle's medium (Life Technologies) supplemented with 7.5% (vol/vol) fetal calf serum at 37°C in an atmosphere of 95% air-5%
CO2. The cloned dace NHE3 (dNHE3) and dace NBC1 (dNBC1)
cDNA were introduced into the pECE vector and transfected into PS120
cells (5 × 105 cells/10-cm dish) by means of the
calcium phosphate coprecipitation technique. Cell populations that
stably express dNHE3 and dNBC1 were selected by means of the repetitive
H+-killing selection procedure (62). In the
case of dNBC1, recovery medium contained 2 mM NaHCO
Measurement of 22Na+ uptake for dNHE3 activity. The rates of ethylisopropylamiloride (EIPA)-sensitive 22Na+ uptake by PS120 cells expressing dNHE3 were measured using cells clamped at intracellular pH (pHi) 5.6 by the standard K+/nigericin method. For measurement of 22Na+ uptake, cells were preincubated for 1 h in NH4Cl medium (50 mM NH4Cl, 1.8 mM CaCl2, 1 mM MgCl2, 5 mM KCl, 70 mM choline chloride, 5 mM glucose, and 15 mM HEPES-Tris, pH 7.4), washed twice with choline chloride medium (1.8 mM CaCl2, 1 mM MgCl2, 5 mM KCl, 120 mM choline chloride, 5 mM glucose, and 15 mM HEPES-Tris, pH 7.4), and then incubated for 15 min in the same medium additionally containing 1 mM 22NaCl (370 kBq/ml), 1 mM ouabain, and various concentrations of EIPA. Cells were washed four times with ice-cold, nonradioactive choline chloride medium, and then 22Na+ radioactivity was counted.
pHi measurement for dNBC1 activity.
Changes in pHi were monitored using the acetoxymethyl ester
of the pH-sensitive fluorescent dye
2',7'-bis(2-carboxyethyl)-5(6)-carboxyfluorescein (BCECF-AM), as described previously (2, 58, 59).
Transfected cells were grown to 70-80% confluent density on
coverslips and serum starved for 10 h to arrest growth. At the
start of the experiment, the culture medium was removed, incubated in
the presence of 2 µM BCECF in a choline chloride medium for 5 min,
and washed to remove extracellular dye. The coverslip was mounted in a
cuvette, and cells were pulsed in NH4Cl medium in the
presence of 30 mM Na+ or 30 mM HCO

Xenopus oocyte electrophysiology for dNBC1 activity.
dNBC1 cDNA (4.5 kb) including untranslated regions was subcloned
into a Xenopus oocyte expression vector, pGEMHE. The
resulting plasmid was linearized with NheI and then used as
a template for cRNA synthesis from the T7 promoter using mMessage
mMachine (Ambion, Austin, TX). Fifty nanoliters of dNBC1 cRNA (0.5 µg/µl) or water (control) were injected into
collagenase-dissociated, stage V-VI Xenopus oocyte, as
previously described (53). On days 3-10
after cRNA injection, transport activity was studied using
pHi and voltage microelectrodes in a constant-perfusion
chamber, as described elsewhere (53). pH electrodes were
calibrated with traceable pH 6.0 and 8.0 solutions and had slopes of
about
56 mV/pH unit. Oocyte solutions were those used previously
(53) titrated to pH 7.5 and ~200 mosM.
CO2/HCO

Immunohistochemistry and immunofluorescence. Ten dace were acclimated in neutral water for 2 wk and then transferred to acidic water. On day 5 after transfer, gills were removed and fixed for 2 h in PBS containing 4% (wt/vol) paraformaldehyde at 4°C. After fixation, they were separated into two groups and embedded in Tissue Tek OCT compound or in paraffin. Frozen sections (6 µm) and paraffin-embedded sections (4 µm) were prepared, immersed in PBS containing 1% H2O2, exposed to 2% normal goat serum, and incubated with affinity-purified primary antibodies. Primary antibodies were generated in rabbits in response to injection with B subunit of dace V-ATPase (a partial 160-residue recombinant protein fused to a histidine tag), dace CA-II (a full-length 260-residue recombinant protein fused to a histidine tag), dNHE3 (a 20-residue COOH-terminal synthetic peptide linked to keyhole limpet hemocyanin: DASVDEEASEEKPGKNHTRL), NBC1 (a 42-residue COOH-terminal fragment fused to a histidine tag: SDFPAIENVPSIKISMETMEQDPVLGEKPSDRNKPMSFLTPY), or AQP3 (a 20-residue COOH-terminal synthetic peptide linked to keyhole limpet hemocyanin: DKTNKDMEESLKLNDVTGKN), and they were purified on HiTrap NHS-activated HP columns (Amersham Biosciences) containing the corresponding immobilized antigen. The antibodies were used at dilutions of 1:3,000 (anti-CA-II), 1:32,000 (anti-NHE3), 1:10,000 (anti-NBC1), or 1:3,000 (anti-AQP3). For staining of Na+-K+-ATPase, an antiserum to the eel protein that cross-reacts with the dace protein was used (36). After the sections were washed in PBS, they were incubated with peroxidase-conjugated secondary antibodies (Dako), and the peroxidase was detected with diaminobenzidine.
For double staining, rat antiserum against Na+-K+- ATPase was produced employing the same antigen used for generating rabbit antiserum mentioned above (36). Primary immunization of rats (WKY/NCrj, Charles River) was performed by injecting 70 µg of purified recombinant protein emulsified in complete Freund's adjuvant into lymph nodes. Two subsequent booster injections consisting of 70 µg of protein were given subcutaneously at 2-wk intervals. Rat antibodies to Na+-K+-ATPase were affinity purified as described above. Double immunofluorescence was performed by applying a mixture of rabbit and rat primary antibodies and a mixture of non-cross-reacting secondary antibodies. For visualization, bound primary antibodies were detected by incubation with anti-rat IgG Cy3-conjugated (Jackson ImmunoResearch Laboratories; 1:3,000) and anti-rabbit IgG Alexa 488-conjugated (Molecular Probes; 1:3,000) secondary antibodies together with Hoechst 33342 (Molecular Probes; 100 ng/ml). Immunofluorescence microscopy was carried out using an Olympus IX70 microscope.Western blot analysis. Neutral water and acidic water dace gills were homogenized in 100 mM Tris buffer containing 0.9% NaCl, 0.2 mM phenylmethylsulfonyl fluoride, 10 mg/ml pepstatin, and 10 mg/ml leupeptin. The homogenates were centrifuged at 5,000 g for 20 min, and the pellets were resuspended in the same buffer. These procedures were repeated three times at 4°C. The membrane proteins were separated by SDS-PAGE and transferred to Immobilon polyvinylidene difluoride membrane (Millipore). After the membrane was blocked in Tris-buffered saline with Tween 20 [150 mM NaCl, 0.05% (vol/vol) Tween 20, and 10 mM Tris · HCl, pH 8.0] containing 5% (vol/vol) nonfat milk for 1 h at room temperature, it was incubated with anti-B subunit of V-ATPase antiserum at 1:3,000 dilution for 10 h at 4°C. After it was washed, the membrane was incubated for 1 h at room temperature with an alkaline phosphatase-conjugated mouse anti-rabbit IgG antibody (Sigma) diluted 1:5,000 in Tris-buffered saline-Tween 20. The membrane was then developed with 0.4 mM 5-bromo-4-chloro-3-indolyl phosphate and 0.4 mM nitro blue tetrazolium chloride (Wako Pure Chemicals) in 0.1 mM Tris · HCl, pH 9.5, containing 50 mM MgCl2 and 150 mM NaCl.
In situ hybridization. In situ hybridization histochemistry was performed with paraffin-embedded sections (4 µm) according to the protocol recommended by the manufacturer of a digoxigenin RNA labeling kit (http://biochem.roche.com/biochemica/no1_98/p10.pdf). Sections were subjected to hybridization with a digoxigenin-labeled cRNA probe of 315 bp that is complementary to the mRNA sequence encoding a central portion of CA-II that includes the signature sequence; the corresponding 315-bp sense probe was used as a control.
| |
RESULTS AND DISCUSSION |
|---|
|
|
|---|
Extraordinary abilities of Osorezan dace to prevent acidification
and loss of Na+.
Previous physiological studies have demonstrated remarkable acid
tolerance of the Osorezan dace (25, 35). We confirmed this
by measuring changes of blood pH and plasma Na+ after
transfer of the Osorezan dace from neutral to acidic (pH 3.5) water and
by comparing them with those of control dace (Fig. 1). The blood pH and plasma
Na+ concentration of the control dace declined continuously
in the acidic environment, and most of them died within 36 h. In
contrast, in the case of the Osorezan dace, the blood pH and
Na+ concentration, which were once lowered, were restored
to close-to-normal levels in 24 h, and they all survived (Fig. 1).
|
Relatively small changes in V-ATPase levels. The gills of the fish are the primary site of ionic and acid-base regulation. The favored model proposes that an apically oriented V-ATPase plays a major role in acid-base regulation and uptake of Na+ from the environment by excreting acid (H+) and providing a driving force to apical membrane Na+ channels (32, 45, 46). To begin to understand the molecular mechanisms of the acid tolerance of the Osorezan dace, the expression levels of V-ATPase were examined using a specific cDNA probe and antiserum with the expectation that if it is a key molecule for acid adaptation, its levels would be greatly elevated in the gill when the dace is transferred from neutral to acidic water.
Poly(A)+ RNA was isolated from the dace gill, reverse transcribed, and used as a template for PCR. A 480-bp cDNA fragment coding for the V-ATPase B subunit was obtained by PCR (DDBJ/EMBL/GenBank accession no. AB094793) and used for Northern blot analysis as a probe. On Northern analysis using mRNA preparations from the gills of dace in neutral and acidic water, a single mRNA species of 2.6 kb was detected, but its band intensities were relatively weak and exhibited only a slight increase in the samples from acidified dace gills (Fig. 2A). Also at the protein level, we were unable to detect a large difference between gill extracts of dace acclimated to neutral and those of dace acclimated to acidic water (Fig. 2B); the amount of the B subunit increased only slightly (<50%) during acid adaptation of the Osorezan dace.
|
Marked elevation of
Na+-K+-ATPase
mRNA in the gill but not in the kidney.
In a parallel attempt, we tried to identify genes that are highly
expressed in acid-adapted Osorezan dace by constructing a subtraction
cDNA library from mRNA preparations of the gills of the Osorezan dace
acclimated to neutral and pH 3.5 water. Sequencing of cDNA clones of
the subtraction library indicated the presence of
Na+-K+-ATPase (DDBJ/EMBL/GenBank accession no.
AB056155) in a relatively high proportion, suggesting that the
Na+-K+-ATPase message is highly elevated in the
gill of acid-adapted Osorezan dace. Indeed, Northern blot analysis
indicated a marked induction of
Na+-K+- ATPase mRNA in the gill on
acidification (Fig. 3). However, its
levels in the kidney, one of the richest sources of
Na+-K+-ATPase, were not significantly affected
by acidification (Fig. 3B). This marked induction of
branchial Na+-K+-ATPase mRNA, together with the
accumulating evidence for the role of the fish gill in ion transport
beginning with Smith's study in 1930 (57), provided the
initial clue that the ion transport systems in the gill might be
responsible for the acid tolerance of the Osorezan dace, because
Na+-K+-ATPase has been demonstrated to have an
important role in driving a variety of ion-transporting processes. We
believed that CA and the downstream ion transporters that have long
been recognized to participate in the control of pH in a variety of
tissues including the branchial epithelium (21, 69) may
play major roles and initiated the studies described below.
|
CA-II levels and locations.
A CA cDNA probe was obtained by RT-PCR performed with Osorezan dace
gill mRNA and a set of primers based on the highly conserved regions of
CAs cloned previously. A full-length cDNA was then isolated from a dace
gill cDNA library. Sequence analysis indicated that the cDNA encodes
CA-II, which is composed of 260 amino acid residues (DDBJ/EMBL/GenBank
accession no. AB055617; Fig.
4A); such isoforms are
cytosolic and possess the highest catalytic activity of the 11 different active isoforms of CA identified to date, which include
cytoplasmic, mitochondrial, and membrane-bound forms (38,
56). CA-II is expressed in a wide variety of mammalian tissues.
However, Northern blot analysis revealed that CA-II mRNA was present in
substantial amounts only in the gill and anterior intestine of
acid-exposed Osorezan dace; RNA preparations from these organs of
control fish maintained in neutral water yielded only a faint
hybridizing band under the same conditions (Fig. 4C).
Transfer of fish to acidic water resulted in a marked induction of
CA-II mRNA in the gill within 1 day (Fig. 4B).
Immunohistochemistry with gill sections revealed that CA-II is
localized to the chloride cells (see Fig. 8, A and
B). In situ hybridization demonstrated that CA-II mRNA is
highly expressed in the chloride cells of the gill (data not shown).
|
Cloning and Northern analysis of NHE3 and NBC1.
Similar approaches were adopted to identify candidates for the proteins
that mediate the transport of H+ and
HCO
Structural and functional properties of dNHE3 and dNBC1.
The nucleotide sequence of the full-length open reading frame of dNHE3
cDNA indicated that it encodes an integral membrane protein of 827 amino acid residues with 12 transmembrane spans (DDBJ/EMBL/GenBank
accession no. AB055466; Fig. 4D). The dNHE3 shares a
relatively high similarity with the mammalian counterparts in its
membrane-spanning domains, but it is quite divergent in the
intracellular COOH-terminal region (Fig. 4D). For
determining its functional property, a cell line stably expressing
dNHE3 was established by transfecting PS120 cells, a cell line lacking
NHEs (47), with the expression vector pECE carrying the
coding region of dNHE3, and its Na+/H+ exchange
activity was measured using 22Na+ (Fig.
5). The activity was seen only in the
transfected cells and was sensitive to EIPA (Fig. 5A), a
derivative of amiloride. Compared with mammalian NHE1 and NHE3
(63), the dace exchanger was closer to the NHE3 isoform in
its amiloride sensitivity (Fig. 5B), consistent with the
classification based on the sequence similarity.
|









|














|

Immunohistochemical localization of NHE3 and NBC1.
To clarify the physiological roles of NHE3 and NBC1, we investigated
whether these proteins are located in the apical or basolateral membrane of chloride cells. We therefore first prepared specific antisera to the most COOH-terminal fragments (20-42-residue long) of these proteins. Immunohistochemical analysis with the resulting antibodies revealed the presence of marked NHE3 immunoreactivity on the
apical side of chloride cells (Fig. 8,
C and D), whereas NBC1 immunoreactivity was
localized to the basolateral membrane that forms the tubular network
(and thereby increases the cell surface area) by extensive infolding
into the cytoplasmic space (Fig. 8E). This latter structural
feature renders the staining patterns of proteins in the basolateral
membrane indistinguishable from those of cytoplasmic proteins. The
Na+-K+-ATPase, a marker protein of the
basolateral membrane of the chloride cell (55), yielded a
staining pattern similar to that of NBC1 (Fig. 8F). Their
colocalization was, however, not complete; NBC1-positive cells appear
to represent a subpopulation of the
Na+-K+-ATPase-positive chloride cells. We
therefore performed double-immunofluorescence staining for NBC1 and
Na+-K+-ATPase. Indeed, a subpopulation of
Na+-K+-ATPase-positive cells were stained with
anti-NBC1 (Fig. 9). Also noteworthy is a
follicular arrangement of chloride cells in the acid-adapted dace gill
(Fig. 8D), which was not seen in the neutral water-acclimated Osorezan dace (data not shown) (25). This
follicular arrangement may be one of the strategies to exclude
H+ efficiently.
|
|
Role of NHE3. Members of the NHE family of proteins are present in the plasma membranes of virtually all animal cells, where they mediate the electroneutral exchange of intracellular H+ for external Na+ with a 1:1 stoichiometry (9, 43, 64). Seven NHE isoforms (NHE1-NHE7) have been identified in mammalian cells and share a membrane topology characterized by 12 transmembrane domains in the NH2-terminal region and a large COOH-terminal tail located in the cytosol. The isoforms NHE1-NHE4 are expressed in epithelial cells; NHE5 is abundant in the brain; NHE6 (42) is an endoplasmic reticulum/recycling endosomal isoform (5, 37); and NHE7 is in the trans-Golgi network (41). NHE1, NHE6, and NHE7 are widely expressed and are believed to perform housekeeping functions such as the control of pHi and maintenance of ionic homeostasis in subcellular organelles. Among the epithelial isoforms, NHE2 is preferentially expressed in the gastrointestinal tract. NHE3 (60) is confined to the apical membrane of polarized epithelial cells of the kidney (3), gastrointestinal tract (22), and fish gill (13), and it is therefore believed to perform specialized functions. The structure (Fig. 4D) and predicted function of dNHE3 are consistent with this notion. The relatively divergent COOH-terminal tail of dNHE3 suggests that a specific mechanism may be responsible for regulation of its function. Chloride cells are rich in mitochondria, are metabolically active, and contain large amounts of Na+-K+-ATPase, a membrane-bound enzyme that couples ATP hydrolysis to the exchange of Na+ and K+ with a 3:2 stoichiometry to maintain a low intracellular Na+ concentration (7, 26, 34, 68). This Na+ pump activity and the protons generated by CA-II may provide the driving force for NHE3 (see Fig. 11A). Recently, Edwards et al. (12) isolated a partial cDNA clone of NHE3 from the gills of the Atlantic hagfish and showed by RT-PCR that its message levels in the gill were elevated more than four times after an induced metabolic acidosis. In this marine fish, downhill Na+ influx can be used for H+ efflux; but in the case of Osorezan dace, such a large concentration gradient of Na+ is not available; furthermore, a steep (>1,000-fold) uphill H+ transport is necessary. Whether this problem can be overcome by strong induction alone of the driving-force providing CA-II and Na+-K+-ATPase remains to be established. The follicular arrangement of the chloride cells in acid-acclimated Osorezan dace may make some contribution by partially sealing the lumen of the follicle from low-pH lake water.
Role of NBC1.
NBC mediates the coupled transport of Na+ and
HCO


1:2 (an electrogenic
process). The electrogenic nature of NBC1-mediated ion transport (Fig.
7B) suggests that the efflux of HCO



Potential role of AQP3. An attempt to identify genes that are specifically expressed in dace gill under acidic conditions by screening a subtracted cDNA library suggested that the gene for the water channel AQP3 (DDBJ/EMBL/GenBank accession no. AB055465) might be one such candidate (for the initial cloning and review of aquaporins, see Refs. 16, 23, 48). Northern blot analysis revealed that AQP3 mRNA is enriched in the gill compared with other tissues of acid-adapted dace (Fig. 4L) and that its abundance in this tissue is markedly increased within 1 day of the transfer of fish to acidic water (Fig. 4K). We therefore determined the predicted amino acid sequence of dace AQP3 (Fig. 4J), prepared antibodies to a synthetic peptide based on this sequence, and examined the expression of this protein in the gill by immunohistochemistry. Marked AQP3 staining was observed in the chloride cells (Fig. 8G) in a pattern that resembled that of Na+-K+- ATPase immunoreactivity (Fig. 8H). This observation suggests that acid-induced expression of AQP3 results in stimulation of water transport across the basolateral membrane and, thereby, provides a substrate for CA-II (see Fig. 11A). Although not illustrated in Fig. 11, the possibility also exists that AQP3 is somehow involved in osmoregulation (e.g., indirect involvement in Na+ uptake), because Cutler and Cramb (11) and Lignot and coworkers (31) recently demonstrated a marked downregulation of AQP3 in eel gill chloride cells after seawater acclimation. Another potential role of AQP3 may be acceleration of ammonia secretion, because its relative, AQP1, has been demonstrated to transport ammonia (40), and it is known that 1) freshwater fish excrete a higher percentage of total body ammonia across the gills than marine teleosts (66, 67) and 2) plasma ammonia levels increase in the Amazonian tambaqui on transfer from neutral to acidic water (71).
Role of glutamine catabolism.
In mammals, it has been established that increased renal ammoniagenesis
and gluconeogenesis (see Fig. 11B) constitute an adaptive response for restoring acid-base balance during metabolic acidosis (10). To determine whether the system plays a role in acid
adaptation of the Osorezan dace, we measured induction of its component
GDH (Fig. 10) by Northern blot
analysis. A partial 173-bp cDNA for dace GDH exhibiting 97% sequence
similarity to human GDH was obtained by RT-PCR (DDBJ/EMBL/GenBank
accession no. AB094342) and used as a hybridization probe. Large
inductions of GDH mRNA were observed in all tissues examined when dace
were exposed to acid (Fig. 10B). This increase in ubiquitous
tissues is a marked contrast to the tissue- and cell-specific increases
of CA-II, NHE3, NBC1, Na+-K+-ATPase, and AQP3
descried above (Figs. 3 and 4).
|

NH3 + H+), cannot directly cross the cell membrane, but it can
be transported across the basolateral membrane by substitution for
K+ on the Na+-K+-ATPase, because
the hydrated radius of NH


Proposed mechanism.
In survival of the Osorezan dace, the combined roles of 1)
CA and its upstream (AQP3) and downstream molecules (NHE3 and NBC1) in
chloride cells of the gill and 2) ammoniagenesis and
gluconeogenesis in various tissues are schematically shown in Fig.
11. As a coarse adjustment taking place
in the chloride cell, CA-II, a Zn2+-containing enzyme,
provides HCO

|
-ketoglutarate, which enters the tricarboxylic acid
cycle and is sequentially converted to malate, which leaves the
mitochondria. Malate is then oxidized in the cytosol to oxaloacetate, which is subsequently converted to phosphoenolpyruvate and
then to glucose. Conversion of glutamine to
-ketoglutarate generates two ammonium ions, and further catabolism of
-ketoglutarate yields two bicarbonate ions, which help compensate for reduced systemic pH,
which is not completely accomplished by the chloride cells. Ammonia may
be directly excreted from the gill without being metabolized by the
liver to urea in a process that consumes bicarbonate and ATP.
Additionally, part of the resultant HCO

Perspectives
We have shown, at the molecular level, that the chloride cells of the gill play an important role in maintaining acid-base balance and that this ability is greatly exaggerated in the Osorezan dace. The expression of the molecules, identified here and expected to be involved in such pH and ion regulation, appears to be finely tuned. Analysis of their gene structures, especially of the promoter regions, and identification of corresponding trans-acting regulators of transcription will help us understand the mechanism of the orchestration and the enhanced expression in the chloride cells of the Osorezan dace. For the analysis of the coordinated expression of multiple genes that encode the regulatory enzymes in the glutamine catabolic pathway, the information obtained from studies on an analogous system in the mammalian renal proximal tubules (10) will be helpful. Another interesting feature of the Osorezan dace is the acid-induced formation of the follicular arrangement of chloride cells that is not seen in neutral water. The Osorezan dace will therefore also be useful for studying the mechanism of follicle formation; among the clones identified by subtraction cloning were cDNAs encoding the ezrin-radixin-moesin family of proteins, key regulatory molecules in linking F-actin to specific membrane proteins, especially in cell surface structures.| |
ACKNOWLEDGEMENTS |
|---|
We thank Dr. Tetsuya Hirano for discussions and encouragement and Akira Kato, Fumi Kato, Ako Takamori, Yoko Saruta, Susanti Hidayat, Azzania Fibriani, Setsuko Sato, Shojiro Kuroda, Sato Kuroda, Akira Oyagi, and Nathan Angle for technical and secretarial assistance.
| |
FOOTNOTES |
|---|
This work was supported by Ministry of Education, Culture, Sport, Science, and Technology of Japan Grants-in-Aid for Scientific Research 0910200 and 14104002, Ministry of Health, Labour, and Welfare of Japan Research Grant for Cardiovascular Diseases 11C-1, and National Institute of Diabetes and Digestive and Kidney Diseases Grants DK-56218 and DK-60845 (to M. F. Romero).
Address for reprint requests and other correspondence: S. Hirose, Dept. of Biological Sciences, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama 226-8501, Japan (E-mail: shirose{at}bio.titech.ac.jp).
The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
First published January 16, 2003;10.1152/ajpregu.00267.2002
Received 13 May 2002; accepted in final form 14 January 2003.
| |
REFERENCES |
|---|
|
|
|---|
1.
Abuladze, N,
Lee I,
Newman D,
Hwang J,
Boorer K,
Pushkin A,
and
Kurtz I.
Molecular cloning, chromosomal localization, tissue distribution, and functional expression of the human pancreatic sodium bicarbonate cotransporter.
J Biol Chem
273:
17689-17695,
1998
2.
Amlal, H,
Wang Z,
and
Soleimani M.
Functional upregulation of H+-ATPase by lethal acid stress in cultured inner medullary collecting duct cells.
Am J Physiol Cell Physiol
273:
C1194-C1205,
1997
3.
Biemesderfer, D,
Pizzonia J,
Abu-Alfa A,
Exner M,
Reilly R,
Igarashi P,
and
Aronson PS.
NHE3: a Na+/H+ exchanger isoform of renal brush border.
Am J Physiol Renal Fluid Electrolyte Physiol
265:
F736-F742,
1993
4.
Boron, WF,
and
Boulpaep EL.
Intracellular pH regulation in the renal proximal tubule of the salamander. Basolateral HCO
5.
Brett, CL,
Wei Y,
Donowitz M,
and
Rao R.
Human Na+/H+ exchanger isoform 6 is found in recycling endosomes of cells, not in mitochondria.
Am J Physiol Cell Physiol
282:
C1031-C1041,
2002
6.
Brosnan, JT,
Vinay P,
Gougoux A,
and
Halperin ML.
Renal ammonia production and its implications for acid-base balance.
In: pH Homeostasis
Mechanism and Control, edited by Häussinger D.. New York: Academic, 1988, p. 281-304.
7.
Claiborne, JB,
Edwards SL,
and
Morrison-Shetlar AI.
Acid-base regulation in fishes: cellular and molecular mechanisms.
J Exp Zool
293:
302-319,
2002[Web of Science][Medline].
8.
Claiborne, JB,
Perry E,
Bellows S,
and
Campbell J.
Mechanisms of acid-base excretion across the gills of a marine fish.
J Exp Zool
279:
509-520,
1997.
9.
Counillon, L,
and
Pouyssegur J.
The expanding family of eucaryotic Na+/H+ exchanger.
J Biol Chem
275:
1-4,
2000
10.
Curthoys, NP,
and
Gstraunthaler G.
Mechanism of increased renal gene expression during metabolic acidosis.
Am J Physiol Renal Physiol
281:
F381-F390,
2001
11.
Cutler, CP,
and
Cramb G.
Branchial expression of an aquaporin 3 (AQP-3) homologue is downregulated in the European eel Anguilla anguilla following seawater acclimation.
J Exp Biol
205:
2643-2651,
2002
12.
Edwards, SL,
Claiborne JB,
Morrison-Shetlar AI,
and
Toop T.
Expression of Na+/H+ exchanger mRNA in the gills of the Atlantic hagfish (Myxine glutinosa) in response to metabolic acidosis.
Comp Biochem Physiol A Physiol
130:
81-91,
2001.
13.
Edwards, SL,
Tse CM,
and
Toop T.
Immunolocalisation of NHE3-like immunoreactivity in the gills of the rainbow trout (Oncorhynchus mykiss) and the blue-throated wrasse (Pseudolabrus tetrious).
J Anat
195:
465-469,
1999.
14.
Finbow, ME,
and
Harrison MA.
The vacuolar H+-ATPase: a universal proton pump of eukaryotes.
Biochem J
324:
697-712,
1997.
15.
Forgac, M.
Structure and properties of the vacuolar H+- ATPases.
J Biol Chem
274:
12951-12954,
1999
16.
Fushimi, K,
Uchida S,
Hara Y,
Hirata Y,
Marumo F,
and
Sasaki S.
Cloning and expression of apical membrane water channel of rat kidney collecting tubule.
Nature
361:
549-552,
1993[Medline].
17.
Garvin, JL,
Burg MB,
and
Knepper MA.
Ammonium replaces potassium in supporting sodium transport by the Na+-K+ ATPase of renal proximal straight tubules.
Am J Physiol Renal Fluid Electrolyte Physiol
249:
F785-F788,
1985
18.
Goss, GG,
Perry SF,
Wood CM,
and
Laurent P.
Mechanisms of ion and acid-base regulation at the gills of freshwater fish.
J Exp Zool
263:
143-159,
1992[Web of Science][Medline].
19.
Grichtchenko, II,
Romero MF,
and
Boron WF.
Extracellular HCO
20.
Hamm, LL,
and
Alpern RJ.
Cellular mechanisms of renal tubular acidification.
In: The Kidney (3rd ed.), edited by Seldin DW,
and Giebisch G.. Philadelphia, PA: Lippincott Williams & Wilkins, 2000, p. 1935-1979.
21.
Haswell, MS,
Randall DJ,
and
Perry SF.
Fish gill carbonic anhydrase: acid-base regulation or salt transport?
Am J Physiol Regul Integr Comp Physiol
238:
R240-R245,
1980
22.
Hoogerwerf, WA,
Tsao SC,
Devuyst O,
Levine SA,
Yun CH,
Yip JW,
Cohen ME,
Wilson PD,
Lazenby AJ,
Tse CM,
and
Donowitz M.
NHE2 and NHE3 are human and rabbit intestinal brush-border proteins.
Am J Physiol Gastrointest Liver Physiol
270:
G29-G41,
1996
23.
Ishibashi, K,
Kuwahara M,
and
Sasaki S.
Molecular biology of aquaporins.
Rev Physiol Biochem Pharmacol
141:
1-32,
2000[Web of Science][Medline].
24.
Ishibashi, K,
Sasaki S,
and
Marumo F.
Molecular cloning of a new sodium bicarbonate cotransporter cDNA from human retina.
Biochem Biophys Res Commun
246:
535-538,
1998[Web of Science][Medline].
25.
Kaneko, T,
Hasegawa S,
Uchida K,
Ogasawara T,
Oyagi A,
and
Hirano T.
Acid tolerance of Japanese dace (a cyprinid teleost) in Lake Osorezan, a remarkable acid lake.
Zool Sci
16:
871-877,
1999.
26.
Karl, J,
and
Karnaky KJ, Jr.
Osmotic and ionic regulation.
In: The Physiology of Fishes (2nd ed.), edited by Evans DH.. Boca Raton, FL: CRC, 1998, p. 157-176.
27.
Kinsella, JL,
and
Aronson PS.
Interaction of NH
28.
Kurtz, I,
and
Balaban RS.
Ammonium as a substrate for Na+-K+-ATPase in rabbit proximal tubules.
Am J Physiol Renal Fluid Electrolyte Physiol
250:
F497-F502,
1986
29.
Leino, RL,
and
McCormick JH.
Morphological and morphometrical changes in chloride cells of the gills of Pimephales promelas after chronic exposure to acid water.
Cell Tissue Res
236:
121-128,
1984[Web of Science][Medline].
30.
Leino, RL,
McCormick JH,
and
Jensen KM.
Changes in gill histology of fathead minnows and yellow perch transferred to soft water or acidified soft water with particular reference to chloride cells.
Cell Tissue Res
250:
389-399,
1987.
31.
Lignot, JH,
Cutler CP,
Hazon N,
and
Cramb G.
Immunolocalisation of aquaporin 3 in the gill and the gastrointestinal tract of the European eel Anguilla anguilla (L.).
J Exp Biol
205:
2653-2663,
2002
32.
Lin, H,
and
Randall D.
Proton pumps in fish gills.
In: Cellular and Molecular Approaches to Fish Ionic Regulation, edited by Wood CM,
and Shuttleworth TJ.. San Diego, CA: Academic, 1995, p. 229-255.
33.
Lindley, TE,
Scheiderer CL,
Walsh PJ,
Wood CM,
Bergman HL,
Bergman AL,
Laurent P,
Wilson P,
and
Anderson PM.
Muscle as the primary site of urea cycle enzyme activity in an alkaline lake-adapted tilapia, Oreochromis alcalicus grahami.
J Biol Chem
274:
29858-29861,
1999
34.
Marshall, WS.
Na+, Cl
, Ca2+ and Zn2+ transport by fish gills: retrospective review and prospective synthesis.
J Exp Zool
293:
264-283,
2002[Web of Science][Medline].
35.
Masiko, K.
Limnological study of Lake Osorezan-ko, a remarkable acidotrophic lake in Japan.
Sci Rep Tohoku Imp Univ 4th Ser Biol
15:
331-356,
1940.
36.
Mistry, AC,
Honda S,
Hirata T,
Kato A,
and
Hirose S.
Eel urea transporter is localized to chloride cells and is salinity dependent.
Am J Physiol Regul Integr Comp Physiol
281:
R1594-R1604,
2001
37.
Miyazaki, E,
Sakaguchi M,
Wakabayashi S,
Shigekawa M,
and
Mihara K.
NHE6 protein possesses a signal peptide destined for endoplasmic reticulum membrane and localizes in secretory organelles of the cell.
J Biol Chem
276:
49221-49227,
2001
38.
Mori, K,
Ogawa Y,
Ebihara K,
Tamura N,
Tashiro K,
Kuwahara T,
Mukoyama M,
Sugawara A,
Ozaki S,
Tanaka I,
and
Nakao K.
Isolation and characterization of CA XIV, a novel membrane-bound carbonic anhydrase from mouse kidney.
J Biol Chem
274:
15701-15705,
1999
39.
Nagami, GT.
Renal ammonia production and excretion.
In: The Kidney (3rd ed.), edited by Seldin DW,
and Giebisch G.. Philadelphia, PA: Lippincott Williams & Wilkins, 2000, p. 1995-2013.
40.
Nakhoul, NL,
Hering-Smith KS,
Abdulnour-Nakhoul SM,
and
Hamm LL.
Transport of NH3/NH
41.
Numata, M,
and
Orlowski J.
Molecular cloning and characterization of a novel (Na+,K+)/H+ exchanger localized to the trans-Golgi network.
J Biol Chem
276:
17387-17394,
2001
42.
Numata, M,
Petrecca K,
Lake N,
and
Orlowski J.
Identification of a mitochondrial Na+/H+ exchanger.
J Biol Chem
273:
6951-6959,
1998
43.
Orlowski, J,
and
Grinstein S.
Na+/H+ exchangers of mammalian cells.
J Biol Chem
272:
22373-22376,
1997
44.
Perry, SF.
The chloride cell: structure and function in the gills of freshwater fishes.
Annu Rev Physiol
59:
325-347,
1997[Web of Science][Medline].
45.
Perry, SF,
Beyers ML,
and
Johnson DA.
Cloning and molecular characterisation of the trout (Oncorhynchus mykiss) vacuolar H+-ATPase B subunit.
J Exp Biol
203:
459-470,
2000[Abstract].
46.
Potts, WT.
Kinetics of sodium uptake in freshwater animals: a comparison of ion-exchange and proton pump hypotheses.
Am J Physiol Regul Integr Comp Physiol
266:
R315-R320,
1994
47.
Pouyssegur, J,
Sardet C,
Franchi A,
L'Allemain G,
and
Paris S.
A specific mutation abolishing Na+/H+ antiport activity in hamster fibroblasts precludes growth at neutral and acidic pH.
Proc Natl Acad Sci USA
81:
4833-4837,
1984
48.
Preston, GM,
Carroll TP,
Guggino WB,
and
Agre P.
Appearance of water channels in Xenopus oocytes expressing red cell CHIP28 protein.
Science
256:
385-387,
1992
49.
Pushkin, A,
Abuladze N,
Lee I,
Newman D,
Hwang J,
and
Kurtz I.
Cloning, tissue distribution, genomic organization, and functional characterization of NBC3, a new member of the sodium bicarbonate cotransporter family.
J Biol Chem
274:
16569-16575,
1999
50.
Pushkin, A,
Abuladze N,
Newman D,
Lee I,
Xu G,
and
Kurtz I.
Cloning, characterization and chromosomal assignment of NBC4, a new member of the sodium bicarbonate cotransporter family.
Biochim Biophys Acta
1493:
215-218,
2000[Medline].
51.
Randall, DJ,
Wood CM,
Perry SF,
Bergman H,
Maloiy GM,
Mommsen TP,
and
Wright PA.
Urea excretion as a strategy for survival in a fish living in a very alkaline environment.
Nature
337:
165-166,
1989[Medline].
52.
Romero, MF,
and
Boron WF.
Electrogenic Na+/HCO
53.
Romero, MF,
Hediger MA,
Boulpaep EL,
and
Boron WF.
Expression cloning and characterization of a renal electrogenic Na+/HCO
54.
Sciortino, CM,
and
Romero MF.
Cation and voltage dependence of rat kidney electrogenic Na+-HCO
55.
Shirai, N.
Electron-microscope localization of sodium ions and adenosine triphosphatase in chloride cells of the Japanese eel, Anguilla japonica.
J Fac Sci Univ Tokyo Sec IV
12:
385-403,
1972.
56.
Sly, WS,
and
Hu PY.
Human carbonic anhydrases and carbonic anhydrase deficiencies.
Annu Rev Biochem
64:
375-401,
1995[Web of Science][Medline].
57.
Smith, HW.
The absorption and excretion of salts by marine teleosts.
Am J Physiol
93:
480-505,
1930
58.
Soleimani, M,
Singh G,
Bizal GL,
Gullans SR,
and
McAteer JA.
Na+/H+ exchanger isoforms NHE-2 and NHE-1 in inner medullary collecting duct cells. Expression, functional localization, and differential regulation.
J Biol Chem
269:
27973-27978,
1994
59.
Soleimani, M,
Singh G,
Dominguez JH,
and
Howard RL.
Long-term high osmolality activates Na+-H+ exchange and protein kinase C in aortic smooth muscle cells.
Circ Res
76:
530-535,
1995
60.
Tse, CM,
Brant SR,
Walker MS,
Pouyssegur J,
and
Donowitz M.
Cloning and sequencing of a rabbit cDNA encoding an intestinal and kidney-specific Na+/H+ exchanger isoform (NHE-3).
J Biol Chem
267:
9340-9346,
1992
61.
Vander, AJ.
Renal regulation of hydrogen-ion balance.
In: Renal Physiology (5th ed.). New York: McGraw-Hill, 1995, p. 162-189.
62.
Wakabayashi, S,
Fafournoux P,
Sardet C,
and
Pouyssegur J.
The Na+/H+ antiporter cytoplasmic domain mediates growth factor signals and controls "H+-sensing."
Proc Natl Acad Sci USA
89:
2424-2428,
1992
63.
Wakabayashi, S,
Ikeda T,
Noel J,
Schmitt B,
Orlowski J,
Pouyssegur J,
and
Shigekawa M.
Cytoplasmic domain of the ubiquitous Na+/H+ exchanger NHE1 can confer Ca2+ responsiveness to the apical isoform NHE3.
J Biol Chem
270:
26460-26465,
1995
64.
Wakabayashi, S,
Shigekawa M,
and
Pouyssegur J.
Molecular physiology of vertebrate Na+/H+ exchangers.
Physiol Rev
77:
51-74,
1997
65.
Wendelaar Bonga, SE,
Flik G,
Balm PHM,
and
van der Meij JA.
The ultrastructure of chloride cells in the gills of the teleost Oreochromis mossambicus during exposure to acidified water.
Cell Tissue Res
259:
575-585,
1990.
66.
Wilkie, MP.
Mechanisms of ammonia excretion across fish gills.
Comp Biochem Physiol A Physiol
118:
39-50,
1997.
67.
Wilkie, MP.
Ammonia excretion and urea handling by fish gills: present understanding and future research challenges.
J Exp Zool
293:
284-301,
2002[Web of Science][Medline].
68.
Wilson, JM,
and
Laurent P.
Fish gill morphology: inside out.
J Exp Zool
293:
192-213,
2002[Web of Science][Medline].
69.
Wilson, JM,
Randall DJ,
Donowitz M,
Vogl AW,
and
Ip AK.
Immunolocalization of ion-transport proteins to branchial epithelium mitochondria-rich cells in the mudskipper (Periophthalmodon schlosseri).
J Exp Biol
203:
2297-2310,
2000[Abstract].
70.
Wilson, RW,
Wood CM,
Gonzalez RJ,
Patrick ML,
Bergman HL,
Narahara A,
and
Val AL.
Ion and acid-base balance in three species of Amazonian fish during gradual acidification of extremely soft water.
Physiol Biochem Zool
72:
277-285,
1999[Web of Science][Medline].
71.
Wood, CM,
Wilson RW,
Gonzalez RJ,
Patrick ML,
Bergman HL,
Narahara A,
and
Val AL.
Responses of an Amazonian teleost, the tambaqui (Colossoma macropomum), to low pH in extremely soft water.
Physiol Zool
71:
658-670,
1998[Medline].
This article has been cited by other articles:
![]() |
C. R. Sussman, J. Zhao, C. Plata, J. Lu, C. Daly, N. Angle, J. DiPiero, I. A. Drummond, J. O. Liang, W. F. Boron, et al. Cloning, localization, and functional expression of the electrogenic Na+ bicarbonate cotransporter (NBCe1) from zebrafish Am J Physiol Cell Physiol, October 1, 2009; 297(4): C865 - C875. [Abstract] [Full Text] [PDF] |
||||
![]() |
P.-P. Hwang Ion uptake and acid secretion in zebrafish (Danio rerio) J. Exp. Biol., June 1, 2009; 212(11): 1745 - 1752. [Abstract] [Full Text] [PDF] |
||||
![]() |
B.-K. Liao, R.-D. Chen, and P.-P. Hwang Expression regulation of Na+-K+-ATPase {alpha}1-subunit subtypes in zebrafish gill ionocytes Am J Physiol Regulatory Integrative Comp Physiol, June 1, 2009; 296(6): R1897 - R1906. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Inokuchi, J. Hiroi, S. Watanabe, P.-P. Hwang, and T. Kaneko Morphological and functional classification of ion-absorbing mitochondria-rich cells in the gills of Mozambique tilapia J. Exp. Biol., April 1, 2009; 212(7): 1003 - 1010. [Abstract] [Full Text] [PDF] |
||||
![]() |
J.-L. Horng, L.-Y. Lin, and P.-P. Hwang Functional regulation of H+-ATPase-rich cells in zebrafish embryos acclimated to an acidic environment Am J Physiol Cell Physiol, April 1, 2009; 296(4): C682 - C692. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. K. N. Tsui, C. Y. C. Hung, C. M. Nawata, J. M. Wilson, P. A. Wright, and C. M. Wood Ammonia transport in cultured gill epithelium of freshwater rainbow trout: the importance of Rhesus glycoproteins and the presence of an apical Na+/NH4+ exchange complex J. Exp. Biol., March 15, 2009; 212(6): 878 - 892. [Abstract] [Full Text] [PDF] |
||||
![]() |
T.-H. Shih, J.-L. Horng, P.-P. Hwang, and L.-Y. Lin Ammonia excretion by the skin of zebrafish (Danio rerio) larvae Am J Physiol Cell Physiol, December 1, 2008; 295(6): C1625 - C1632. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. Deigweiher, N. Koschnick, H.-O. Portner, and M. Lucassen Acclimation of ion regulatory capacities in gills of marine fish under environmental hypercapnia Am J Physiol Regulatory Integrative Comp Physiol, November 1, 2008; 295(5): R1660 - R1670. [Abstract] [Full Text] [PDF] |
||||
![]() |
G. Ivanis, M. Braun, and S. F. Perry Renal expression and localization of SLC9A3 sodium/hydrogen exchanger and its possible role in acid-base regulation in freshwater rainbow trout (Oncorhynchus mykiss) Am J Physiol Regulatory Integrative Comp Physiol, September 1, 2008; 295(3): R971 - R978. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Hiroi, S. Yasumasu, S. D. McCormick, P.-P. Hwang, and T. Kaneko Evidence for an apical Na-Cl cotransporter involved in ion uptake in a teleost fish J. Exp. Biol., August 15, 2008; 211(16): 2584 - 2599. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. H. Evans Teleost fish osmoregulation: what have we learned since August Krogh, Homer Smith, and Ancel Keys Am J Physiol Regulatory Integrative Comp Physiol, August 1, 2008; 295(2): R704 - R713. [Abstract] [Full Text] [PDF] |
||||
![]() |
T.-Y. Lin, B.-K. Liao, J.-L. Horng, J.-J. Yan, C.-D. Hsiao, and P.-P. Hwang Carbonic anhydrase 2-like a and 15a are involved in acid-base regulation and Na+ uptake in zebrafish H+-ATPase-rich cells Am J Physiol Cell Physiol, May 1, 2008; 294(5): C1250 - C1260. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Raldua, D. Otero, M. Fabra, and J. Cerda Differential localization and regulation of two aquaporin-1 homologs in the intestinal epithelia of the marine teleost Sparus aurata Am J Physiol Regulatory Integrative Comp Physiol, March 1, 2008; 294(3): R993 - R1003. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. B. Claiborne, K. P. Choe, A. I. Morrison-Shetlar, J. C. Weakley, J. Havird, A. Freiji, D. H. Evans, and S. L. Edwards Molecular detection and immunological localization of gill Na+/H+ exchanger in the dogfish (Squalus acanthias) Am J Physiol Regulatory Integrative Comp Physiol, March 1, 2008; 294(3): R1092 - R1102. [Abstract] [Full Text] [PDF] |
||||
![]() |
J.-J. Yan, M.-Y. Chou, T. Kaneko, and P.-P. Hwang Gene expression of Na+/H+ exchanger in zebrafish H+-ATPase-rich cells during acclimation to low-Na+ and acidic environments Am J Physiol Cell Physiol, December 1, 2007; 293(6): C1814 - C1823. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Nakada, K. Hoshijima, M. Esaki, S. Nagayoshi, K. Kawakami, and S. Hirose Localization of ammonia transporter Rhcg1 in mitochondrion-rich cells of yolk sac, gill, and kidney of zebrafish and its ionic strength-dependent expression Am J Physiol Regulatory Integrative Comp Physiol, October 1, 2007; 293(4): R1743 - R1753. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. M. Piermarini, I. Choi, and W. F. Boron Cloning and characterization of an electrogenic Na/HCO3- cotransporter from the squid giant fiber lobe Am J Physiol Cell Physiol, June 1, 2007; 292(6): C2032 - C2045. [Abstract] [Full Text] [PDF] |
||||
![]() |
G. Akabane, Y. Ogushi, T. Hasegawa, M. Suzuki, and S. Tanaka Gene cloning and expression of an aquaporin (AQP-h3BL) in the basolateral membrane of water-permeable epithelial cells in osmoregulatory organs of the tree frog Am J Physiol Regulatory Integrative Comp Physiol, June 1, 2007; 292(6): R2340 - R2351. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. K. Parks, M. Tresguerres, and G. G. Goss Interactions between Na+ channels and Na+-HCO3- cotransporters in the freshwater fish gill MR cell: a model for transepithelial Na+ uptake Am J Physiol Cell Physiol, February 1, 2007; 292(2): C935 - C944. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Esaki, K. Hoshijima, S. Kobayashi, H. Fukuda, K. Kawakami, and S. Hirose Visualization in zebrafish larvae of Na+ uptake in mitochondria-rich cells whose differentiation is dependent on foxi3a Am J Physiol Regulatory Integrative Comp Physiol, January 1, 2007; 292(1): R470 - R480. [Abstract] [Full Text] [PDF] |
||||
![]() |
K. P. Choe, A. Kato, S. Hirose, C. Plata, A. Sindic, M. F. Romero, J. B. Claiborne, and D. H. Evans NHE3 in an ancestral vertebrate: primary sequence, distribution, localization, and function in gills Am J Physiol Regulatory Integrative Comp Physiol, November 1, 2005; 289(5): R1520 - R1534. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. M. Pelis, S. L. Edwards, S. C. Kunigelis, J. B. Claiborne, and J. L. Renfro Stimulation of renal sulfate secretion by metabolic acidosis requires Na+/H+ exchange induction and carbonic anhydrase Am J Physiol Renal Physiol, July 1, 2005; 289(1): F208 - F216. [Abstract] [Full Text] [PDF] |
||||
![]() |
A.-S. Martinez, C. P. Cutler, G. D. Wilson, C. Phillips, N. Hazon, and G. Cramb Regulation of expression of two aquaporin homologs in the intestine of the European eel: effects of seawater acclimation and cortisol treatment Am J Physiol Regulatory Integrative Comp Physiol, June 1, 2005; 288(6): R1733 - R1743. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. H. Evans, P. M. Piermarini, and K. P. Choe The Multifunctional Fish Gill: Dominant Site of Gas Exchange, Osmoregulation, Acid-Base Regulation, and Excretion of Nitrogenous Waste Physiol Rev, January 1, 2005; 85(1): 97 - 177. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. M. Pelis and J. L. Renfro Role of tubular secretion and carbonic anhydrase in vertebrate renal sulfate excretion Am J Physiol Regulatory Integrative Comp Physiol, September 1, 2004; 287(3): R491 - R501. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. B. Pritchard The gill and homeostasis: transport under stress Am J Physiol Regulatory Integrative Comp Physiol, December 1, 2003; 285(6): R1269 - R1271. [Full Text] [PDF] |
||||
![]() |
R. M. Pelis, J. E. Goldmeyer, J. Crivello, and J. L. Renfro Cortisol alters carbonic anhydrase-mediated renal sulfate secretion Am J Physiol Regulatory Integrative Comp Physiol, December 1, 2003; 285(6): R1430 - R1438. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| Visit Other APS Journals Online |